Skip to Content
Merck
CN
All Photos(1)

Documents

Safety Information

HPA009040

Sigma-Aldrich

Anti-PRRG4 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-Proline-rich γ-carboxyglutamic acid protein 4 antibody produced in rabbit, Anti-Proline-rich Gla protein 4 antibody produced in rabbit, Anti-Transmembrane γ-carboxyglutamic acid protein 4 precursor antibody produced in rabbit
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200-1:500

immunogen sequence

NRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PRRG4(79056)

General description

PRRG4 (proline rich γ-carboxyglutamic acid 4) is a plasma membrane protein, which is composed of putative WW and SH3 binding motifs in its cytoplasmic domain. It contains a transmembrane domain and a Gla domain, a pro peptide and a signal peptide in its extracellular region. It is a ubiquitously expressed protein, with the highest expression in kidney, breast, lung, thyroid and the lowest expression in jejunum, proximal colon, duodenum and uterus. This gene localizes to human chromosome 11.

Immunogen

Transmembrane γ-carboxyglutamic acid protein 4 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

PRRG4 (proline rich γ-carboxyglutamic acid 4) gene is deleted in pateints with WAGR (Wilms tumor, Aniridia, genitourinary malformations, and mental retardation) syndrome. Studies in BALB/c mice, show that this gene is one of the most highly expressed genes in mesenteric lymph node in response to three common food allergens. Genome wide association studies (GWAS) show that SNP (single nucleotide polymorphism) for Parkinson′s disease (PD) with the lowest p-value lies in PRRG4 gene region.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71969

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yang Wang et al.
Cancer cell international, 23(1), 323-323 (2023-12-16)
Breast cancer is the leading cause of cancer death for women worldwide. Most of the breast cancer death are due to disease recurrence and metastasis. Increasingly accumulating evidence indicates that mitochondria play key roles in cancer progression and metastasis. Our
Jeanne C Latourelle et al.
BMC medical genetics, 10, 98-98 (2009-09-24)
Age at onset in Parkinson disease (PD) is a highly heritable quantitative trait for which a significant genetic influence is supported by multiple segregation analyses. Because genes associated with onset age may represent invaluable therapeutic targets to delay the disease
Mustafa N Yazicioglu et al.
The Journal of biological chemistry, 288(36), 25908-25914 (2013-07-23)
The genes encoding a family of proteins termed proline-rich γ-carboxyglutamic acid (PRRG) proteins were identified and characterized more than a decade ago, but their functions remain unknown. These novel membrane proteins have an extracellular γ-carboxyglutamic acid (Gla) protein domain and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service