Anti-NFIA antibody produced in rabbit

Nuclear factor I A (NFIA) gene is located on the human chromosome 1p31.3. NFIA transcription factor is a member of the NFI family. This protein is highly expressed in brown adipocytes.

Nuclear factor 1 A-type recombinant protein epitope signature tag (PrEST)

Sequence
VKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGA

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-NFIA antibody produced in rabbit has been used in:

• immunohistochemistry
• chromatin immunoprecipitation
• immunocytochemistry
• proximity ligation assay

NFIA (nuclear factor I/A) determine the fate of glia and plays an essential role in glial development in the central nervous system. It determines glial identity, maintains the progenitors of glia, and controls the transcription of glial fibrillary acidic protein (GFAP), thus, regulating astrocyte differentiation. It determines the erythroid or granulocytic fate of hematopoietic progenitor cells, and controls the expression of β-globin and G-CSF (granulocyte-colony stimulating factor) receptor. In human myelin disorders, it prevents remyelination by regulating oligodendrocyte progenitor differentiation.

Nuclear factor I A (NFIA) gene is involved in the induction of brown adipogenesis. The deletion of the NFIA gene is associated with developmental delay, metopic synostosis and hypoplasia of the corpus callosum. Defects in the NFIA gene also leads to urinary tract abnormalities.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70958

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.