Skip to Content
Merck
CN
All Photos(6)

Documents

Safety Information

HPA005482

Sigma-Aldrich

Anti-IL17RB antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-Cytokine receptor CRL4, Anti-IL-17 receptor B, Anti-IL-17 receptor homolog 1, Anti-IL-17B receptor, Anti-IL-17RB, Anti-IL-17Rh1, Anti-IL17Rh1, Anti-Interleukin-17 receptor B precursor, Anti-Interleukin-17B receptor
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50-1:200

immunogen sequence

QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IL17RB(55540)

General description

Interleukin 17 receptor B (IL17RB) is a member of the IL-17 receptor (IL17R) family. It makes a heterodimeric receptor complex along with IL17RA. This family of proteins has a single transmembrane domain, which contains fibronectin type-III (FnIII) domain. They have an extracellular domain and a cytosolic domain which contains the unique SEFIR [SEF (similar expression to fibroblast growth factor genes) and IL-17R] domain. IL17RB acts as a receptor for IL17B as well as IL17E. In humans, this gene is located on chromosome 3p21.1. The molecular weight of IL17RB is 56kDa. It is expressed on lung fibroblasts, basophils along with CD4+ Th2 memory cells.

Immunogen

Interleukin-17 receptor B precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-IL17RB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Interleukin 17 receptor B (IL17RB) expression is induced by Th2 cytokines, in antigen presenting cells. Induction of IL17RB leads to inflammatory responses via activation of Jun kinase (JNK), nuclear factor-κB and p38 mitogen-activated protein kinase (MAPK). Therefore, polymorphisms in this gene are associated with asthma, and can be used as markers to determine the risk of developing asthma. Studies suggest that IL17RB is the only gene, whose transcription varies in accordance with the IgE levels in asthmatics. Exposure to natural allergens leads to elevated levels of IL17RB in patients with seasonal allergic rhinitis (SAR). Blocking of this protein prevents lung inflammation and thus, IL17RB can be a potential therapeutic target for allergies.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86465

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Bing Zhang et al.
Journal of immunology (Baltimore, Md. : 1950), 190(5), 2320-2326 (2013-01-29)
IL-17 cytokines play a crucial role in a variety of inflammatory and autoimmune diseases. They signal through heterodimeric receptor complexes consisting of members of IL-17R family. A unique intracellular signaling domain was identified within all IL-17Rs, termed similar expression to
Yuri Matsumoto et al.
Allergology international : official journal of the Japanese Society of Allergology, 60(1), 87-92 (2011-01-22)
Seasonal allergic rhinitis (SAR) to Japanese cedar (Cryptomeria japonica; JC) is an IgE-mediated type I allergy affecting the nasal mucosa. However, the molecular mechanisms that underlie SAR are only partially understood. The aim of the study was to identify novel
Ji-Sun Jung et al.
Chest, 135(5), 1173-1180 (2009-01-02)
Interleukin (IL)-17E is a member of the IL-17 family, which induces IL-4, IL-5, IL-13, and eotaxin in experimental animals via IL-17 receptor B (IL-17RB). The activation of IL-17RB amplifies allergic-type inflammatory responses by inducing Jun kinase (or JNK), p38 mitogen-activated
Gary M Hunninghake et al.
BMC pulmonary medicine, 11, 17-17 (2011-04-09)
The relationships between total serum IgE levels and gene expression patterns in peripheral blood CD4+ T cells (in all subjects and within each sex specifically) are not known. Peripheral blood CD4+ T cells from 223 participants from the Childhood Asthma
Chiaki Ono et al.
PloS one, 9(11), e111405-e111405 (2014-11-08)
Peripheral blood samples have been subjected to comprehensive gene expression profiling to identify biomarkers for a wide range of diseases. However, blood samples include red blood cells, white blood cells, and platelets. White blood cells comprise polymorphonuclear leukocytes, monocytes, and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service