Skip to Content
Merck
CN
All Photos(6)

Documents

Safety Information

HPA003254

Sigma-Aldrich

Anti-OLIG2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Class B basic helix- loop-helix protein 1, Anti-Oligo2, Anti-Oligodendrocyte transcription factor 2, Anti-Protein kinase C-binding protein 2, Anti-Protein kinase C-binding protein RACK17, Anti-bHLHB1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:2500-1:5000

immunogen sequence

SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... OLIG2(10215)

General description

OLIG2 (oligodendrocyte lineage transcription factor 2) is a transcription factor (TF) belonging to the basic-helix-loop-helix (bHLH) TF family. It is expressed in human glioblastoma and neural progenitor cells. It is a member of the Olig family, and has a predominant expression in ventral spinal cord of human embryo, during initial developmental stages. In spinal cord, it is essential for the maturation of oligodendrocyte progenitor cells.

Immunogen

Oligodendrocyte transcription factor 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-OLIG2 antibody produced in rabbit has been used in immunohistochemistry and western blotting.

Biochem/physiol Actions

OLIG2 (oligodendrocyte lineage transcription factor 2) is expressed in the pMN domain of the spinal cord, where the formation of motoneurons and differentiation of oligodendrocytes occur. Along with Olig1, another protein of the same family, Olig2 participates in specification of neurons, astrocytes, and oligodendrocytes. The gene is mapped to a region on chromosome 21 that has been implicated in learning deficits associated with Down syndrome. It is predominantly expressed in oligodendroglial tumors of the brain and serves as a biomarker for oligodendroglial tumor diagnosis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84779

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A Dual SILAC Proteomic Labeling Strategy for Quantifying Constitutive and Cell--Cell Induced Protein Secretion.
Stiess M, et al.
Journal of Proteome Research, 14(8), 3229-3238 (2015)
Multifocal and multicentric low-grade oligoastrocytoma in a young patient.
Grosu F, et al.
Romanian Journal of Morphology and Embryology, 58(1), 207-210 (2017)
B G Novitch et al.
Neuron, 31(5), 773-789 (2001-09-25)
Within the developing vertebrate nervous system, the mechanisms that coordinate neuronal subtype identity with generic features of neuronal differentiation are poorly defined. We show here that a bHLH protein, Olig2, is expressed selectively by motor neuron progenitors and has a
Louis Larrouquère et al.
International journal of molecular sciences, 22(19) (2021-10-14)
Glioblastoma (GBM) is the most aggressive malignant glioma, with a very poor prognosis; as such, efforts to explore new treatments and GBM's etiology are a priority. We previously described human GBM cells (R2J-GS) as exhibiting the properties of cancer stem
Lina Chakrabarti et al.
Nature neuroscience, 13(8), 927-934 (2010-07-20)
Over-inhibition is thought to be one of the underlying causes of the cognitive deficits in Ts65Dn mice, the most widely used model of Down syndrome. We found a direct link between gene triplication and defects in neuron production during embryonic

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service