Skip to Content
Merck
CN
All Photos(8)

Key Documents

Safety Information

HPA002111

Sigma-Aldrich

ANTI-KDM6A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-UTX, Anti-Ubiquitously transcribed TPR protein on the X chromosome, Anti-Ubiquitously transcribed X chromosome tetratricopeptide repeat protein

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UTX(7403)

General description

Lysine-specific demethylase 6A (KDM6A) is a tumor suppressor gene mapped to human chromosome Xp11.3. The gene codes for histone H3 lysine 27 (H3K27) demethylase, which is a member of the switch/sucrose non-fermentable (SWI/SNF) family.

Immunogen

Ubiquitously transcribed X chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the X chromosome)

Sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT

Application

ANTI-KDM6A antibody produced in rabbit has been used in western blotting and immunoprecipitation.

Biochem/physiol Actions

Lysine-specific demethylase 6A (KDM6A) counteracts zeste homolog 2 (EZH2) function and induces tumor suppression by stimulating gene transcription of E-cadherin, cell cycle regulators and tumor-suppressing subchromosomal transferable fragments. It also eliminates trimethylation marks from histone 3 lysine 27 (H3K27) and supports histone demethylase activity through its catalytic JmjC domain. Mutation in the gene leads to the development of a rare congenital anomaly syndrome, Kabuki syndrome (KS).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85171

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Novel KDM6A splice-site mutation in kabuki syndrome with congenital hydrocephalus: a case report
Guo Z, et al.
BMC Medical Genetics, 19(1), 206-206 (2018)
Histone demethylase KDM6A controls the mammary luminal lineage through enzyme-independent mechanisms
Yoo K, et al.
Molecular and Cellular Biology, 36(16), 2108-2120 (2016)
Inhibition of EZH2 induces NK cell-mediated differentiation and death in muscle-invasive bladder cancer
Ramakrishnan S, et al.
Cell Death and Differentiation, 26(10), 2100-2114 (2019)
Epigenetic regulation of epithelial-mesenchymal transition by KDM6A histone demethylase in lung cancer cells
Terashima M, et al.
Biochemical and Biophysical Research Communications, 490(4), 1407-1413 (2017)
Kyung Hyun Yoo et al.
Molecular and cellular biology, 36(16), 2108-2120 (2016-05-25)
Establishment of the mammary luminal cell lineage is controlled primarily by hormones and through specific transcription factors (TFs). Previous studies have linked histone methyltransferases to the differentiation of mammary epithelium, thus opening the possibility of biological significance of counteracting demethylases.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service