HPA002111
ANTI-KDM6A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-UTX, Anti-Ubiquitously transcribed TPR protein on the X chromosome, Anti-Ubiquitously transcribed X chromosome tetratricopeptide repeat protein
Sign Into View Organizational & Contract Pricing
All Photos(7)
About This Item
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... UTX(7403)
Related Categories
General description
Lysine-specific demethylase 6A (KDM6A) is a tumor suppressor gene mapped to human chromosome Xp11.3. The gene codes for histone H3 lysine 27 (H3K27) demethylase, which is a member of the switch/sucrose non-fermentable (SWI/SNF) family.
Immunogen
Ubiquitously transcribed X chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the X chromosome)
Sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Application
ANTI-KDM6A antibody produced in rabbit has been used in western blotting and immunoprecipitation.
Biochem/physiol Actions
Lysine-specific demethylase 6A (KDM6A) counteracts zeste homolog 2 (EZH2) function and induces tumor suppression by stimulating gene transcription of E-cadherin, cell cycle regulators and tumor-suppressing subchromosomal transferable fragments. It also eliminates trimethylation marks from histone 3 lysine 27 (H3K27) and supports histone demethylase activity through its catalytic JmjC domain. Mutation in the gene leads to the development of a rare congenital anomaly syndrome, Kabuki syndrome (KS).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST85171
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Histone demethylase KDM6A controls the mammary luminal lineage through enzyme-independent mechanisms
Yoo K, et al.
Molecular and Cellular Biology, 36(16), 2108-2120 (2016)
Novel KDM6A splice-site mutation in kabuki syndrome with congenital hydrocephalus: a case report
Guo Z, et al.
BMC Medical Genetics, 19(1), 206-206 (2018)
Inhibition of EZH2 induces NK cell-mediated differentiation and death in muscle-invasive bladder cancer
Ramakrishnan S, et al.
Cell Death and Differentiation, 26(10), 2100-2114 (2019)
Epigenetic regulation of epithelial-mesenchymal transition by KDM6A histone demethylase in lung cancer cells
Terashima M, et al.
Biochemical and Biophysical Research Communications, 490(4), 1407-1413 (2017)
Kyung Hyun Yoo et al.
Molecular and cellular biology, 36(16), 2108-2120 (2016-05-25)
Establishment of the mammary luminal cell lineage is controlled primarily by hormones and through specific transcription factors (TFs). Previous studies have linked histone methyltransferases to the differentiation of mammary epithelium, thus opening the possibility of biological significance of counteracting demethylases.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service