Anti-IL1B antibody produced in rabbit

Interleukin-1β (IL1β) is produced by activated macrophages. It is synthesized as pro-IL-1β which is changed to active form IL-1β with the help of pro-inflammatory protease caspase-1. IL-1β belongs to the IL-1 gene family. It is a proinflammatory cytokine. The gene is mapped to human chromosome 2q14.

Synthetic peptide directed towards the N terminal region of human IL1B

Anti-IL1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Interleukins are proinflammatory cytokines produced on cell injury or trauma. There are two closely related types of interleukins produced by the cell, IL-1α and IL-1β that are produced by the activation of NF-κB transcription factor in response to bacterial infection or LPS. Both IL-1α and IL-1β exert their cellular effects by signalling through IL-1 receptor type 1. IL-1β has pleiotropic activities and is protective against infections by recruitment of neutrophils to the infection site, secretion of cytokines and chemokines and activation of adhesion molecules. IL-1β overproduction has been implicated in many auto-immune and allergic disorders such as Cryopirin-associated periodic syndromes, Muckle-Wells syndrome and skin lesions.

Synthetic peptide located within the following region: DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.