AV54268
Anti-ATG16L1 (AB1) antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(3)
Synonym(s):
Anti-APG16L, Anti-ATG16 autophagy related 16-like 1 (S. cerevisiae), Anti-ATG16L, Anti-FLJ00045, Anti-FLJ10035, Anti-FLJ10828, Anti-FLJ22677, Anti-IBD10
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
66 kDa
species reactivity
rat, mouse, bovine, human, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ATG16L1(55054)
Immunogen
Synthetic peptide directed towards the N terminal region of human ATG16L1
Application
Anti-ATG16L1 (AB1) antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions
ATG16L1 (autophagy related 16-like 1) is an autophagy-related (ATG) protein. It plays an essential role as a component of the ATG12-ATG5-ATG16L1 complex during autophagy. It functions as a molecular scaffold to form the autophagosome in response to classical and pathogen-related autophagy stimuli. The complex introduces LC3 (ATG8 in yeast) to the autophagosome and connects it to the phosphatidylethanolamine (PE). This conjugation generates a membrane-bound activated form of LC3 named LC3-II.
Sequence
Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Joëlle Magné et al.
Arteriosclerosis, thrombosis, and vascular biology, 35(5), 1226-1235 (2015-03-15)
Autophagy has emerged as a cell survival mechanism critical for cellular homeostasis, which may play a protective role in atherosclerosis. ATG16L1, a protein essential for early stages of autophagy, has been implicated in the pathogenesis of Crohn's disease. However, it
Rhiannon Parkhouse et al.
PloS one, 8(9), e76237-e76237 (2013-10-03)
Autophagy is a fundamental cellular process required for organelle degradation and removal of invasive pathogens. Autophagosome formation involves the recruitment of, and interaction between, multiple proteins produced from autophagy-related (ATG) genes. One of the key complexes in autophagosome formation is
Emilio Boada-Romero et al.
The EMBO journal, 32(4), 566-582 (2013-02-05)
Selective autophagy underlies many of the important physiological roles that autophagy plays in multicellular organisms, but the mechanisms involved in cargo selection are poorly understood. Here we describe a molecular mechanism that can target conventional endosomes for autophagic degradation. We
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service