AV49203
Anti-POLQ antibody produced in rabbit
affinity isolated antibody, lyophilized powder
Synonym(s):
Anti-Polymerase (DNA directed), theta
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
species reactivity
bovine, mouse, rat, human
technique(s)
western blot: suitable
immunogen sequence
SFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKLRL
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... POLQ(10721)
Immunogen
synthetic peptide corresponding to a region of human POLQ with an internal ID of S24206
Application
Anti-POLQ antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Biochem/physiol Actions
Polymerase (DNA directed), theta (POLQ) is a DNA polymerase and helicase involved in base excision repair and maintenance of genomic instability against ionizing radiations. Loss of POLQ activity results in increased DNA damage signaling whereas increased activity indicates poor cancer prognosis.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
13 - Non Combustible Solids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Matthew J Yousefzadeh et al.
DNA repair, 12(1), 1-9 (2012-12-12)
In mammalian cells, POLQ (pol θ) is an unusual specialized DNA polymerase whose in vivo function is under active investigation. POLQ has been implicated by different experiments to play a role in resistance to ionizing radiation and defense against genomic
Tatiana Kent et al.
Nature structural & molecular biology, 22(3), 230-237 (2015-02-03)
Microhomology-mediated end-joining (MMEJ) is an error-prone alternative double-strand break-repair pathway that uses sequence microhomology to recombine broken DNA. Although MMEJ has been implicated in cancer development, the mechanism of this pathway is unknown. We demonstrate that purified human DNA polymerase
Geoff S Higgins et al.
Oncotarget, 1(3), 175-184 (2010-08-12)
Depletion of POLQ (DNA polymerase theta) has recently been shown to render tumour cells more sensitive to radiotherapy whilst having little or no effect on normal tissues. This finding led us to investigate whether tumours that overexpress POLQ are associated
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service