Skip to Content
Merck
CN
All Photos(1)

Key Documents

Safety Information

AV49203

Sigma-Aldrich

Anti-POLQ antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonym(s):

Anti-Polymerase (DNA directed), theta

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

species reactivity

bovine, mouse, rat, human

technique(s)

western blot: suitable

immunogen sequence

SFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKLRL

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... POLQ(10721)

Immunogen

synthetic peptide corresponding to a region of human POLQ with an internal ID of S24206

Application

Anti-POLQ antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

Polymerase (DNA directed), theta (POLQ) is a DNA polymerase and helicase involved in base excision repair and maintenance of genomic instability against ionizing radiations. Loss of POLQ activity results in increased DNA damage signaling whereas increased activity indicates poor cancer prognosis.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

13 - Non Combustible Solids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tatiana Kent et al.
Nature structural & molecular biology, 22(3), 230-237 (2015-02-03)
Microhomology-mediated end-joining (MMEJ) is an error-prone alternative double-strand break-repair pathway that uses sequence microhomology to recombine broken DNA. Although MMEJ has been implicated in cancer development, the mechanism of this pathway is unknown. We demonstrate that purified human DNA polymerase
Matthew J Yousefzadeh et al.
DNA repair, 12(1), 1-9 (2012-12-12)
In mammalian cells, POLQ (pol θ) is an unusual specialized DNA polymerase whose in vivo function is under active investigation. POLQ has been implicated by different experiments to play a role in resistance to ionizing radiation and defense against genomic
Geoff S Higgins et al.
Oncotarget, 1(3), 175-184 (2010-08-12)
Depletion of POLQ (DNA polymerase theta) has recently been shown to render tumour cells more sensitive to radiotherapy whilst having little or no effect on normal tissues. This finding led us to investigate whether tumours that overexpress POLQ are associated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service