AV48273
Anti-ALDOC antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
Synonym(s):
Anti-ALDC, Anti-Aldolase C, fructose-bisphosphate
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
39 kDa
species reactivity
dog, rat, human, bovine, horse, guinea pig, rabbit, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ALDOC(230)
General description
ALDOC codes for a class I fructose-biphosphate aldolase that catalyzes the breakdown of fructose-1,6-biphosphate to dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate during glycolysis. It also catalyzes the aldol cleavage of fructose-1 phosphate to DHAP and glyceraldehyde. ALDOC is expressed in the cerebellum, retina and other parts of the CNS. It is known to be upregulated in the brain and skeletal muscles cells of chickens during hypoxia.
Rabbit Anti-ALDOC antibody recognizes bovine, human, mouse, rat, zebrafish, and rabbit ALDOC.
Rabbit Anti-ALDOC antibody recognizes bovine, human, mouse, rat, zebrafish, and rabbit ALDOC.
Immunogen
Synthetic peptide directed towards the N terminal region of human ALDOC
Application
Rabbit Anti-ALDOC antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Sequence
Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
recommended
Product No.
Description
Pricing
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
C F Wang et al.
Animal genetics, 38(3), 203-210 (2007-06-02)
Two sequence variants of the aldolase C (ALDOC) gene were discovered based on comparison of the sequences from an altiplano chicken breed (Tibetan chicken) and two lowland breeds (White Leghorn and ShouGuang). Gel-shift results indicated that one of these variants
Ryota Maruyama et al.
Pathology international, 72(3), 176-186 (2022-02-12)
Colorectal cancer (CRC) is a leading cause of cancer-related death worldwide. The spheroid colony formation assay is a useful method to identify cancer stem cells (CSCs). Using the DLD-1 and WiDr CRC cell lines, we performed microarray analyses of spheroid
Hirofumi Fujita et al.
PloS one, 9(1), e86679-e86679 (2014-01-30)
Aldolase C (Aldoc, also known as "zebrin II"), a brain type isozyme of a glycolysis enzyme, is expressed heterogeneously in subpopulations of cerebellar Purkinje cells (PCs) that are arranged longitudinally in a complex striped pattern in the cerebellar cortex, a
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service