Skip to Content
Merck
CN
All Photos(2)

Key Documents

Safety Information

AV48166

Sigma-Aldrich

Anti-EEF1A1 antibody produced in rabbit

IgG fraction of antiserum, lyophilized powder

Synonym(s):

Anti-CCS-3, Anti-CCS3, Anti-EEF-1, Anti-EEF1A, Anti-EF-Tu, Anti-EF1A, Anti-Eukaryotic translation elongation factor 1 α 1, Anti-FLJ25721

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

50 kDa

species reactivity

pig, rat, mouse, rabbit, horse, human, canine

technique(s)

western blot: suitable

immunogen sequence

SGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKA

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... EEF1A1(1915)

General description

Eukaryotic translation elongation factor 1 α 1 (EEF1A1) regulates the transport of aminoacyl tRNA to the ribosome. Downreguation of eEF1A1 is known to induce cell death in tetraploids. Studies have reported that EEF1A1 functions as a target for the male contraceptive, gamendazole, in rat sertoli cells.
Rabbit Anti-EEF1A1 antibody recognizes chicken, canine, pig, human, mouse, and rat EEF1A1.

Immunogen

synthetic peptide corresponding to a region of human EEF1A1 with an internal ID of P28675

Application

Rabbit Anti-EEF1A1 antibody is suitable for western blot applications at a concentration of 2.5μg/ml.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

11 - Combustible Solids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Joseph S Tash et al.
Biology of reproduction, 78(6), 1139-1152 (2008-01-26)
Gamendazole was recently identified as an orally active antispermatogenic compound with antifertility effects. The cellular mechanism(s) through which these effects occur and the molecular target(s) of gamendazole action are currently unknown. Gamendazole was recently designed as a potent orally active
Y Kobayashi et al.
Cell death and differentiation, 16(1), 139-150 (2008-09-30)
When duplicated sister chromatids are not properly compacted in mitosis, chromosomes are mis-segregated, inducing genetically unstable tetraploidy known to facilitate aneuploid malignancies. Here, we show that tetraploid cells produced by impaired chromosomal condensation are eliminated by a novel type of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service