biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
50 kDa
species reactivity
pig, rat, mouse, rabbit, horse, human, canine
technique(s)
western blot: suitable
immunogen sequence
SGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKA
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... EEF1A1(1915)
Looking for similar products? Visit Product Comparison Guide
General description
Eukaryotic translation elongation factor 1 α 1 (EEF1A1) regulates the transport of aminoacyl tRNA to the ribosome. Downreguation of eEF1A1 is known to induce cell death in tetraploids. Studies have reported that EEF1A1 functions as a target for the male contraceptive, gamendazole, in rat sertoli cells.
Rabbit Anti-EEF1A1 antibody recognizes chicken, canine, pig, human, mouse, and rat EEF1A1.
Rabbit Anti-EEF1A1 antibody recognizes chicken, canine, pig, human, mouse, and rat EEF1A1.
Immunogen
synthetic peptide corresponding to a region of human EEF1A1 with an internal ID of P28675
Application
Rabbit Anti-EEF1A1 antibody is suitable for western blot applications at a concentration of 2.5μg/ml.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
11 - Combustible Solids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Joseph S Tash et al.
Biology of reproduction, 78(6), 1139-1152 (2008-01-26)
Gamendazole was recently identified as an orally active antispermatogenic compound with antifertility effects. The cellular mechanism(s) through which these effects occur and the molecular target(s) of gamendazole action are currently unknown. Gamendazole was recently designed as a potent orally active
Y Kobayashi et al.
Cell death and differentiation, 16(1), 139-150 (2008-09-30)
When duplicated sister chromatids are not properly compacted in mitosis, chromosomes are mis-segregated, inducing genetically unstable tetraploidy known to facilitate aneuploid malignancies. Here, we show that tetraploid cells produced by impaired chromosomal condensation are eliminated by a novel type of
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service