AV48015
Anti-DKK1 antibody produced in rabbit
IgG fraction of antiserum
Sign Into View Organizational & Contract Pricing
All Photos(1)
Synonym(s):
Anti-DKK-1, Anti-Dickkopf homolog 1 (Xenopus laevis), Anti-SK
UNSPSC Code:
12352203
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
26 kDa
species reactivity
pig, guinea pig, bovine, horse, rabbit, zebrafish, sheep, human, rat, goat, canine, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... DKK1(22943)
General description
Dickkopf WNT signaling pathway inhibitor 1 (DKK1) may be involved in embryonic development. Studies in aortic endothelial cells have revealed that Dkk1 modulates endothelial-mesenchymal cells. Downregulation of DKK1 has been linked to colorectal tumorigenesis. Serum DKK1 has been identified has a diagnostic biomarker for hepatocellular carcinoma.
Rabbit Anti-DKK1 antibody recognizes bovine, chicken, zebrafish, pig, canine, mouse, rat, human, and rabbit DKK1.
Rabbit Anti-DKK1 antibody recognizes bovine, chicken, zebrafish, pig, canine, mouse, rat, human, and rabbit DKK1.
Immunogen
The immunogen for anti-DKK1 antibody: synthetic peptide derected towards the C terminal of human DKK1
Application
Rabbit Anti-DKK1 antibody is suitable for western blot applications at a concentration of 2.5μg/ml
Sequence
Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 1
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Qiujin Shen et al.
The Lancet. Oncology, 13(8), 817-826 (2012-06-29)
Hepatocellular carcinoma (HCC) is prevalent worldwide and improvements in timely and effective diagnosis are needed. We assessed whether measurement of Dickkopf-1 (DKK1) in serum could improve diagnostic accuracy for HCC. We analysed data for patients with HCC, chronic hepatitis B
Su-Li Cheng et al.
Arteriosclerosis, thrombosis, and vascular biology, 33(7), 1679-1689 (2013-05-21)
Endothelial cells (ECs) can undergo an endothelial-mesenchymal transition with tissue fibrosis. Wnt- and Msx2-regulated signals participate in arteriosclerotic fibrosis and calcification. We studied the impact of Wnt7, Msx2, and Dkk1, a Wnt7 antagonist, on endothelial-mesenchymal transition in primary aortic ECs.
Zebin Huang et al.
PloS one, 8(7), e70077-e70077 (2013-08-08)
We collected paired samples of tumor and adjacent normal colorectal tissues from 22 patients with colorectal carcinoma to compare the differences in the expression of lysine specific demethylase 1 (LSD1) in these two tissues. The results showed that in 19
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service