Skip to Content
Merck
CN
All Photos(1)

Key Documents

Safety Information

AV48015

Sigma-Aldrich

Anti-DKK1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-DKK-1, Anti-Dickkopf homolog 1 (Xenopus laevis), Anti-SK

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

26 kDa

species reactivity

pig, guinea pig, bovine, horse, rabbit, zebrafish, sheep, human, rat, goat, canine, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... DKK1(22943)

General description

Dickkopf WNT signaling pathway inhibitor 1 (DKK1) may be involved in embryonic development. Studies in aortic endothelial cells have revealed that Dkk1 modulates endothelial-mesenchymal cells. Downregulation of DKK1 has been linked to colorectal tumorigenesis. Serum DKK1 has been identified has a diagnostic biomarker for hepatocellular carcinoma.
Rabbit Anti-DKK1 antibody recognizes bovine, chicken, zebrafish, pig, canine, mouse, rat, human, and rabbit DKK1.

Immunogen

The immunogen for anti-DKK1 antibody: synthetic peptide derected towards the C terminal of human DKK1

Application

Rabbit Anti-DKK1 antibody is suitable for western blot applications at a concentration of 2.5μg/ml

Sequence

Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Regulatory Information

常规特殊物品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Su-Li Cheng et al.
Arteriosclerosis, thrombosis, and vascular biology, 33(7), 1679-1689 (2013-05-21)
Endothelial cells (ECs) can undergo an endothelial-mesenchymal transition with tissue fibrosis. Wnt- and Msx2-regulated signals participate in arteriosclerotic fibrosis and calcification. We studied the impact of Wnt7, Msx2, and Dkk1, a Wnt7 antagonist, on endothelial-mesenchymal transition in primary aortic ECs.
Qiujin Shen et al.
The Lancet. Oncology, 13(8), 817-826 (2012-06-29)
Hepatocellular carcinoma (HCC) is prevalent worldwide and improvements in timely and effective diagnosis are needed. We assessed whether measurement of Dickkopf-1 (DKK1) in serum could improve diagnostic accuracy for HCC. We analysed data for patients with HCC, chronic hepatitis B
Zebin Huang et al.
PloS one, 8(7), e70077-e70077 (2013-08-08)
We collected paired samples of tumor and adjacent normal colorectal tissues from 22 patients with colorectal carcinoma to compare the differences in the expression of lysine specific demethylase 1 (LSD1) in these two tissues. The results showed that in 19

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service