AV47410
Anti-TMEM30A antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(3)
Anti-C6orf67, Anti-CDC50A, Anti-FLJ10856, Anti-Transmembrane protein 30A
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
41 kDa
species reactivity
human, dog, guinea pig, horse, rat, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TMEM30A(55754)
General description
TMEM30A codes for a transmembrane protein that is present in the endoplasmic reticulum. Studies have reported that TMEM30A facilitates the import of bioactive and anticancer phospholipids into mammalian cells.
Rabbit Anti-TMEM30A recognizes human, mouse, rat, zebrafish, chicken, canine, and bovine TMEM30A.
Rabbit Anti-TMEM30A recognizes human, mouse, rat, zebrafish, chicken, canine, and bovine TMEM30A.
Immunogen
Synthetic peptide directed towards the middle region of Human TMEM30A
Application
Rabbit Anti-TMEM30A antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for immunohistochemistry at 4-8 μg/ml.
Biochem/physiol Actions
The function of this protein remains unknown.
Sequence
Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Human TMEM30a promotes uptake of antitumor and bioactive choline phospholipids into mammalian cells.
Journal of immunology (Baltimore, Md. : 1950), 186(5), 3215-3225 (2011-02-04)
Antitumor alkylphospholipids initiate apoptosis in transformed HL-60 and Jurkat cells while sparing their progenitors. 1-O-Alkyl-2-carboxymethyl-sn-glycero-3-phosphocholine (Edelfosine) like other short-chained phospholipids--inflammatory platelet-activating factor (PAF) and apoptotic oxidatively truncated phospholipids--are proposed to have intracellular sites of action, yet a conduit for these
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service