AV47093
Anti-SV2A antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(4)
Synonym(s):
Anti-KIAA0736, Anti-SV2, Anti-Synaptic vesicle glycoprotein 2A
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
mol wt
83 kDa
species reactivity
human, guinea pig, mouse, bovine, horse, dog, rabbit, rat
packaging
pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SV2A(9900)
Immunogen
Synthetic peptide directed towards the middle region of human SV2A
Application
Anti-SV2A antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
Biochem/physiol Actions
SV2A (synaptic vesicle glycoprotein 2A) gene is a multi-pass membrane protein that belongs to major facilitator superfamily. It regulates the cytoplasmic Ca2+ levels in the nerve terminal during repetitive stimulation and facilitates the synaptic transmission. SV2A serves as a binding site for the antiepileptic drug levetiracetam and may decrease the neuronal excitability. Mutation in SV2A gene results in schizophrenia.
Sequence
Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
recommended
Product No.
Description
Pricing
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Marjolein de Groot et al.
Neuro-oncology, 12(3), 265-273 (2010-02-20)
Synaptic vesicle protein 2A (SV2A) has been identified as the binding site for the antiepileptic drug levetiracetam and is thought to decrease neuronal excitability. Since knockout of SV2A in mice leads to seizures, we hypothesized that a reduction in SV2A
Manuel Mattheisen et al.
Schizophrenia research, 141(2-3), 262-265 (2012-09-29)
Convergent evidence from pharmacological and animal studies suggests a possible role for the synaptic vesicle glycoprotein 2A gene (SV2A) in schizophrenia susceptibility. To test systematically all common variants in the SV2A gene region for an association with schizophrenia, we used
R Janz et al.
Neuron, 24(4), 1003-1016 (2000-01-07)
SV2 proteins are abundant synaptic vesicle proteins expressed in two major (SV2A and SV2B) and one minor isoform (SV2C) that resemble transporter proteins. We now show that SV2B knockout mice are phenotypically normal while SV2A- and SV2A/SV2B double knockout mice
Emilia Lekholm et al.
Cellular & molecular biology letters, 26(1), 5-5 (2021-02-17)
The synaptic vesicle glycoprotein 2 (SV2) family is essential to the synaptic machinery involved in neurotransmission and vesicle recycling. The isoforms SV2A, SV2B and SV2C are implicated in neurological diseases such as epilepsy, Alzheimer's and Parkinson's disease. Suitable cell systems
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service