AV46626
Anti-RTN2 antibody produced in rabbit
IgG fraction of antiserum
Sign Into View Organizational & Contract Pricing
All Photos(2)
Anti-NSP2, Anti-NSPL1, Anti-Reticulon 2
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
51 kDa
species reactivity
human, rat, pig, horse, mouse, bovine, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RTN2(6253)
Immunogen
Synthetic peptide directed towards the N terminal region of human RTN2
Application
Anti-RTN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.
Biochem/physiol Actions
RTN2 (reticulon 2) gene also referred to as NSP2 or NSPL1 is a member of reticulon encoding gene family. It plays a pivotal role in organizing endoplasmic reticulum and distal motor axons. RTN2B, isoform of RTN2 regulates the trafficking as well as facilitates as a positive modulator for delivering the EAAC1 (excitatory amino acid carrier 1) from ER to the cell surface. Mutation in RTN2 gene leads to axon-degenerative disorder hereditary spastic paraplegia type 12.
Sequence
Synthetic peptide located within the following region: MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Human molecular genetics, 21(15), 3356-3365 (2012-05-01)
Several causative genes for hereditary spastic paraplegia encode proteins with intramembrane hairpin loops that contribute to the curvature of the endoplasmic reticulum (ER), but the relevance of this function to axonal degeneration is not understood. One of these genes is
The Journal of clinical investigation, 122(2), 538-544 (2012-01-11)
Hereditary spastic paraplegias (HSPs) are a group of genetically heterogeneous neurodegenerative conditions. They are characterized by progressive spastic paralysis of the legs as a result of selective, length-dependent degeneration of the axons of the corticospinal tract. Mutations in 3 genes
The Journal of biological chemistry, 283(10), 6561-6571 (2007-12-22)
Excitatory amino acid transporters (EAATs) are the primary regulators of extracellular glutamate concentrations in the central nervous system. Their dysfunction may contribute to several neurological diseases. To date, five distinct mammalian glutamate transporters have been cloned. In brain, EAAC1 (excitatory
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service