Skip to Content
Merck
CN

AV45752

Anti-SOD1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-ALS, Anti-ALS1, Anti-Homodimer, Anti-IPOA, Anti-SOD, Anti-SuPeroxide dismutase 1, soluble (aMyotrophic lateral sclerosis 1 (adult))

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
MDL number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

16 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable, western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... SOD1(6647)

Looking for similar products? Visit Product Comparison Guide

General description

Superoxide dismutase 1, soluble (aMyotrophic lateral sclerosis 1 (adult)) (SOD1, ALS1, ALS, IPOA, SOD) is a copper-zinc enzyme that destroys free superoxide radicals in the cytoplasm and mitochondrial inter-membrane space of cells. Mutated SOD1 is linked to familial amyotrophic lateral sclerosis (ALS).

Immunogen

The immunogen for anti-SOD1 antibody: synthetic peptide derected towards the N terminal of human SOD1

Application

Anti-SOD1 polyclonal antibody is used to tag superoxide dismutase 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of superoxide dismutase 1 in cellular oxidative stress defense and as a causative agent in familial amyotrophic lateral sclerosis (ALS).

Biochem/physiol Actions

Anti-SOD1 polyclonal antibody reacts with human superoxide dismutase 1.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

K Marosi et al.
Neuroscience, 226, 21-28 (2012-09-18)
Exercise can exert beneficial effects on cognitive functions of older subjects and it can also play an important role in the prevention of neurodegenerative diseases. At the same time it is perceivable that limited information is available on the nature
Lijun Wang et al.
Neurobiology of disease, 71, 317-324 (2014-08-20)
Approximately 20% of familial amyotrophic lateral sclerosis (FALS) cases are caused by mutant superoxide dismutase type 1 (mtSOD1). Although the mechanisms of mtSOD1-induced toxicity remain poorly understood, evidence suggests that accumulation of misfolded SOD1 is fundamental to its toxicity and
Michelle L Thompson et al.
Disease models & mechanisms, 7(2), 233-243 (2013-12-07)
Molecular mechanisms underlying neurodegenerative diseases converge at the interface of pathways impacting cellular stress, protein homeostasis and aging. Targeting the intrinsic capacities of neuroprotective proteins to restore neuronal function and/or attenuate degeneration represents a potential means toward therapeutic intervention. The
Maryam Amirazodi et al.
BioMed research international, 2022, 8638714-8638714 (2022-12-21)
Mitochondrial dysfunction and increased oxidative stress cause damage to cells which can lead to the aging process and age-related diseases. Antioxidants such as resveratrol and high-intensity exercise can benefit oxidative damage prevention. This study is aimed at evaluating the effects
Kouji Komatsu et al.
Reproduction (Cambridge, England), 147(5), 627-638 (2014-01-25)
Hormonal stimulation in superovulation induces female mice to ovulate more oocytes than spontaneous ovulation. Because the superovulated oocytes contain a number of oocytes that normally regress before spontaneous ovulation or immature oocytes, the development of some embryos that derive from

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service