AV45752
Anti-SOD1 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-ALS, Anti-ALS1, Anti-Homodimer, Anti-IPOA, Anti-SOD, Anti-SuPeroxide dismutase 1, soluble (aMyotrophic lateral sclerosis 1 (adult))
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
MDL number:
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
16 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... SOD1(6647)
General description
Superoxide dismutase 1, soluble (aMyotrophic lateral sclerosis 1 (adult)) (SOD1, ALS1, ALS, IPOA, SOD) is a copper-zinc enzyme that destroys free superoxide radicals in the cytoplasm and mitochondrial inter-membrane space of cells. Mutated SOD1 is linked to familial amyotrophic lateral sclerosis (ALS).
Specificity
Anti-SOD1 polyclonal antibody reacts with human superoxide dismutase 1.
Immunogen
The immunogen for anti-SOD1 antibody: synthetic peptide derected towards the N terminal of human SOD1
Application
Anti-SOD1 polyclonal antibody is used to tag superoxide dismutase 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of superoxide dismutase 1 in cellular oxidative stress defense and as a causative agent in familial amyotrophic lateral sclerosis (ALS).
Sequence
Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Lijun Wang et al.
Neurobiology of disease, 71, 317-324 (2014-08-20)
Approximately 20% of familial amyotrophic lateral sclerosis (FALS) cases are caused by mutant superoxide dismutase type 1 (mtSOD1). Although the mechanisms of mtSOD1-induced toxicity remain poorly understood, evidence suggests that accumulation of misfolded SOD1 is fundamental to its toxicity and
K Marosi et al.
Neuroscience, 226, 21-28 (2012-09-18)
Exercise can exert beneficial effects on cognitive functions of older subjects and it can also play an important role in the prevention of neurodegenerative diseases. At the same time it is perceivable that limited information is available on the nature
Maryam Amirazodi et al.
BioMed research international, 2022, 8638714-8638714 (2022-12-21)
Mitochondrial dysfunction and increased oxidative stress cause damage to cells which can lead to the aging process and age-related diseases. Antioxidants such as resveratrol and high-intensity exercise can benefit oxidative damage prevention. This study is aimed at evaluating the effects
Michelle L Thompson et al.
Disease models & mechanisms, 7(2), 233-243 (2013-12-07)
Molecular mechanisms underlying neurodegenerative diseases converge at the interface of pathways impacting cellular stress, protein homeostasis and aging. Targeting the intrinsic capacities of neuroprotective proteins to restore neuronal function and/or attenuate degeneration represents a potential means toward therapeutic intervention. The
Kouji Komatsu et al.
Reproduction (Cambridge, England), 147(5), 627-638 (2014-01-25)
Hormonal stimulation in superovulation induces female mice to ovulate more oocytes than spontaneous ovulation. Because the superovulated oocytes contain a number of oocytes that normally regress before spontaneous ovulation or immature oocytes, the development of some embryos that derive from
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service