AV45680
Anti-KNG1 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
Anti-BDK, Anti-KNG, Anti-Kininogen 1
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
72 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... KNG1(3827)
General description
Kininogen 1 (KNG1) a precursor of the kinin has recently been identified as possible biomarkers for chronic hepatitis C and proliferative vitreoretinopathy (PVR).
Specificity
Anti-KNG1 polyclonal antibody reacts with human and mouse kininogen 1 proteins.
Immunogen
Synthetic peptide directed towards the middle region of human KNG1
Application
Anti-KNG1 polyclonal antibody is used to tag kininogen 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of kininogen 1 as a potential biomarker for chronic hepatitis C and proliferative vitreoretinopathy (PVR).
Biochem/physiol Actions
Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Sequence
Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service