AV45607
Anti-RORA antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
Anti-MGC119326, Anti-MGC119329, Anti-NR1F1, Anti-RAR-related orphan receptor A, Anti-ROR1, Anti-ROR2, Anti-ROR3, Anti-RZRA
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
62 kDa
species reactivity
horse, pig, rabbit, dog, goat, human, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RORA(6095)
Immunogen
Synthetic peptide directed towards the middle region of human RORA
Application
Anti-RORA antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.
Biochem/physiol Actions
Retinoic acid related orphan receptor A (RORA), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORA is widely expressed and enhances p53-dependent apoptosis. RORA is important for the development of the cerebellum and it is required for the maturation of photoreceptors in the retina.
Sequence
Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Brain research, 1140, 19-25 (2006-01-24)
The staggerer mutation was first identified at the Jackson Laboratory in 1955. In the ensuing half-century, studies of staggerer mice have provided new insights into developmental neurobiology, gene regulatory networks, and circadian behavior. Recent work has expanded the role of
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service