AV44817
Anti-RHOT1 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(3)
Synonym(s):
Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO-1, Anti-Ras homolog gene family, member T1
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
antibody form
affinity isolated antibody
Quality Level
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
71 kDa
species reactivity
rabbit, horse, bovine, rat, human, mouse, guinea pig, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RHOT1(55288)
General description
Anti-RHOT1 polyclonal antibody reacts with RHOT1 in chicken, bovine, human, zebrafish, pig, rat, canine, and mouse.
Ras homolog gene family, member T1 (RHOT1, MIRO-1) is an atypical Rho GTPase involved in calcium sensitive mitochondrial trafficking. Miro interacts with the kinesin-binding proteins GRIF-1 and OIP106 forming a link between the mitochondria and the trafficking apparatus of the microtubules. Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons. Miro1 is a calcium sensor for glutamate receptor-dependent localization of mitochondria at synapses.
Immunogen
Synthetic peptide directed towards the N terminal region of human RHOT1
Application
Anti-RHOT1 polyclonal antibody is suitable for use in western blotting and immunohistochemical (IHC) techniques. The antibody is used as a probe to determine the role of RHOT1 in calcium-sensitive mitochondrial trafficking.
Biochem/physiol Actions
Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Sequence
Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service