AV44694
Anti-MPG antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
Synonym(s):
Anti-AAG, Anti-APNG, Anti-CRA36.1, Anti-MDG, Anti-Mid1, Anti-N-Methylpurine-DNA glycosylase, Anti-PIG11, Anti-PIG16
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
32 kDa
species reactivity
rat, mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MPG(4350)
Immunogen
Synthetic peptide directed towards the C terminal region of human MPG
Application
Anti-MPG antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
N-methylpurine-DNA glycosylase (MPG) is an enzyme that repairs the genome-wide damage caused by alkylating agents. MPG repairs the hypoxanthine that is formed by the deamination of adenine and 1,N6-ethenoadenine formed as a result of interaction of lipid peroxidation-derived aldehydes and hydroxyalkenals with DNA. A functional linkage between MPG and p53; MPG acting as the selective regulator of p53-mediated cell cycle arrest.
Sequence
Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Robyn L Maher et al.
DNA repair, 6(1), 71-81 (2006-10-05)
The base excision repair pathway removes damaged DNA bases and resynthesizes DNA to replace the damage. Human alkyladenine DNA glycosylase (AAG) is one of several damage-specific DNA glycosylases that recognizes and excises damaged DNA bases. AAG removes primarily damaged adenine
Yael Leitner-Dagan et al.
Journal of the National Cancer Institute, 104(22), 1765-1769 (2012-10-30)
Only a minority of smokers develop lung cancer, possibly due to genetic predisposition, including DNA repair deficiencies. To examine whether inter-individual variations in DNA repair activity of N-methylpurine DNA glycosylase (MPG) are associated with lung cancer, we conducted a blinded
Shanshan Song et al.
Cell research, 22(8), 1285-1303 (2012-07-18)
Alkylating agents induce genome-wide base damage, which is repaired mainly by N-methylpurine DNA glycosylase (MPG). An elevated expression of MPG in certain types of tumor cells confers higher sensitivity to alkylation agents because MPG-induced apurinic/apyrimidic (AP) sites trigger more strand
Chun-Yue I Lee et al.
Biochemistry, 48(9), 1850-1861 (2009-02-18)
The human 3-methyladenine DNA glycosylase (AAG) recognizes and excises a broad range of purines damaged by alkylation and oxidative damage, including 3-methyladenine, 7-methylguanine, hypoxanthine (Hx), and 1,N(6)-ethenoadenine (epsilonA). The crystal structures of AAG bound to epsilonA have provided insights into
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service