AV44234
Anti-GUSB antibody produced in rabbit
IgG fraction of antiserum
Sign Into View Organizational & Contract Pricing
All Photos(3)
Anti-Glucuronidase, β, Anti-MPS7
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
72 kDa
species reactivity
mouse, horse, guinea pig, rabbit, human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GUSB(2990)
General description
β-Glucuronidase (GUSB), a lysosomal enzyme, catalyzes the breakdown of complex carbohydrates by hydrolyzing β-D-glucuronic acid residues from the non-reducing end of mucopolysaccharides. GUSB is a stably expressed gene product that may be used to normalize the expression of other genes in processes such as mesenchymal stem cell differentiation.
Specificity
Anti-GUSB polyclonal antibody reacts with canine, bovine, zebrafish, chicken, human, mouse, rat, and pig β-glucuronidase proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human GUSB
Application
Anti-GUSB polyclonal antibody is used to tag β-glucuronidase protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe detect the presence of β-glucuronidase as a gene expression normalization reference protein.
Biochem/physiol Actions
GUSB plays an important role in the degradation of dermatan and keratan sulfates.
Sequence
Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service