AV44073
Anti-SLC22A16 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-6-Oct, Anti-CT2, Anti-FLIPT2, Anti-OKB1, Anti-Solute carrier family 22 (organic cation transporter), member 16, Anti-dJ261K5.1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
63 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SLC22A16(85413)
General description
The previously assigned protein identifier Q96RU0 has been merged into Q86VW1. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human SLC22A16
Application
Anti-SLC22A16 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions
SLC22A16 (CT2; OAT6) is an organic zwitterion transporter protein that transports l-carnitine, a component of mitochondrial fatty acid beta-oxidation process. The transporter does not accept OCT/OCTN cationic or OAT anionic substrates. CT2 is specifically expressed in luminal membrane of epididymal epithelium and within the Sertoli cells of the testis. Human CT2 reportedly mediates the uptake of polyamines and the anticancer drug bleomycin-A5.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Mustapha Aouida et al.
The Journal of biological chemistry, 285(9), 6275-6284 (2009-12-29)
Bleomycin is used in combination with other antineoplastic agents to effectively treat lymphomas, testicular carcinomas, and squamous cell carcinomas of the cervix, head, and neck. However, resistance to bleomycin remains a persistent limitation in exploiting the full therapeutic benefit of
Atsushi Enomoto et al.
The Journal of biological chemistry, 277(39), 36262-36271 (2002-06-29)
l-Carnitine is an essential component of mitochondrial fatty acid beta-oxidation and plays a pivotal role in the maturation of spermatozoa within the male reproductive tract. Epididymal plasma contains the highest levels of l-carnitine found in the human body, and initiation
Yan Wu et al.
Apoptosis : an international journal on programmed cell death, 20(8), 1099-1108 (2015-05-23)
AML (acute myeloid leukemia) cells have a unique reliance on mitochondrial metabolism and fatty acid oxidation (FAO). Thus, blocking FAO is a potential therapeutic strategy to target these malignant cells. In the current study, we assessed plasma membrane carnitine transporters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service