AV43518
Anti-GOT2 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Sign Into View Organizational & Contract Pricing
All Photos(2)
Got2 Antibody, Got2 Antibody - Anti-GOT2 (AB2) antibody produced in rabbit, Anti-FLJ40994, Anti-Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2), Anti-Kat4, Anti-Kativ, Anti-Mitaat
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
45 kDa
species reactivity
rat, rabbit, dog, mouse, horse, human, guinea pig, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GOT2(2806)
Related Categories
General description
Glutamic-oxaloacetic transaminase 2 (GOT2) in an inner-membrane mitochondrial enzyme that interconverts the amino acids aspartate and glutamate and the TCA cycle components α-ketoglutarate and oxaloacetate. The enzyme facilitates a balance between energy metabolism and amino acid composition.
Specificity
Anti-GOT2 (AB2) polyclonal antibody reacts with bovine, pig, chicken, human, mouse, rat, and zebrafish mitochondrial aspartate aminotransferases.
Immunogen
Synthetic peptide directed towards the C terminal region of human GOT2
Application
Anti-GOT2 (AB2) polyclonal antibody is used to tag mitochondrial aspartate aminotransferase protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of mitochondrial aspartate aminotransferase in energy metabolism and amino acid composition management by cells.
Biochem/physiol Actions
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Sequence
Synthetic peptide located within the following region: AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 1
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service