Skip to Content
Merck
CN
All Photos(2)

Key Documents

Safety Information

AV43104

Sigma-Aldrich

Anti-FBXL5 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-F-box and leucine-rich repeat protein 5, Anti-FBL4, Anti-FBL5, Anti-FLR1

Sign Into View Organizational & Contract Pricing

Select a Size


Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

76 kDa

species reactivity

pig, human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

General description

F-box proteins contain an approximately 40 amino acid motif. F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex involved in phosphorylation-dependent ubiquitination. F-box and leucine-rich repeat protein 5 (FBXL5) is an iron sensor that helps regulate iron homeostasis by promoting the ubiquitination and degradation of iron-responsive element-binding protein IRP2.

Specificity

Anti-FBXL5 polyclonal antibody reacts with human, mouse, rat, and bovine F-box and leucine-rich repeat protein 5 proteins.

Immunogen

Synthetic peptide directed towards the middle region of human FBXL5

Application

Anti-FBXL5 polyclonal antibody is used to tag F-box and leucine-rich repeat protein 5 protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of F-box and leucine-rich repeat protein 5 iron homeostasis by degradation of IRP2.

Biochem/physiol Actions

FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL5 belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. Alternative splicing of this gene generates 2 transcript variants.

Sequence

Synthetic peptide located within the following region: VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

NRF2 controls iron homeostasis and ferroptosis through HERC2 and VAMP8.
Anandhan, et al.
Science Advances, 9, eade9585-eade9585 (2023)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service