Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
24 kDa
species reactivity
pig, rabbit, human, rat, mouse, dog, bovine, horse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CHAC1(79094)
General description
CHAC1/MGC4504 (cation transport regulator-like protein 1), a novel gene regulated by the atherosclerotic lesion component ox-PAPC (oxidized 1-palmitoyl-2-arachidonyl-sn-3-glycero-phosphorylcholine), is a proapoptotic component of the ATF4-ATF3-CHOP cascade mediating the unfolded protein response pathway within cells.
Immunogen
Synthetic peptide directed towards the C terminal region of human CHAC1
Application
Anti-CHAC1 polyclonal antibody is used to tag cation transport regulator-like protein 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CHAC1 in the regulation of apoptosis via the unfolded protein response pathway.
Biochem/physiol Actions
Anti-CHAC1 polyclonal antibody reacts with human, canine, bovine, rat, mouse, mouse, rat, and human cation transport regulator-like protein 1 proteins.
CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Nam E Joo et al.
Cancer medicine, 1(3), 295-305 (2013-01-24)
Nisin, a bacteriocin and commonly used food preservative, may serve as a novel potential therapeutic for treating head and neck squamous cell carcinoma (HNSCC), as it induces preferential apoptosis, cell cycle arrest, and reduces cell proliferation in HNSCC cells, compared
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of
Léa Perra et al.
Frontiers in immunology, 9, 2823-2823 (2018-12-18)
In cystic fibrosis (CF), Pseudomonas aeruginosa (Pa) colonizes the lungs, leading to chronic inflammation of the bronchial epithelium. ChaC glutathione-specific γ-glutamylcyclotransferase 1 (CHAC1) mRNA is differentially expressed in primary human airway epithelial cells from bronchi (hAECBs) from patients with CF
Willian Meira et al.
Cancers, 13(6) (2021-04-04)
In our previous study, we showed that a cystine transporter (xCT) plays a pivotal role in ferroptosis of pancreatic ductal adenocarcinoma (PDAC) cells in vitro. However, in vivo xCTKO cells grew normally indicating that a mechanism exists to drastically suppress
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service