AV40961
Anti-SF4 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
Anti-DKFZp434E2216, Anti-F23858, Anti-RBP, Anti-Splicing factor 4
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
72 kDa
species reactivity
bovine, mouse, horse, rat, dog, guinea pig, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SF4(57794)
General description
Splicing factor 4/SURP and G patch domain containing 1 (SF4, RBP, SUGP1) is closely related to SFRS14 (arginine/serine-rich splicing factor 4) which is a potential normalization protein for gene expression studies in HCV-induced hepatocellular carcinoma (HCC).
Specificity
Anti-SF4 polyclonal antibody reacts with canine, bovine, zebrafish, human, mouse, and rat splicing factor 4/SURP and G patch domain containing 1 proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human SF4
Application
Anti-SF4 polyclonal antibody is used to tag splicing factor 4/SURP and G patch domain containing 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of splicing factor 4/SURP and G patch domain containing 1 in spliceosome formation and function.
Biochem/physiol Actions
SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].
Sequence
Synthetic peptide located within the following region: MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
SPF45/RBM17-dependent, but not U2AF-dependent, splicing in a distinct subset of human short introns.
Nature communications, 12(1), 4910-4910 (2021-08-15)
Human pre-mRNA introns vary in size from under fifty to over a million nucleotides. We searched for essential factors involved in the splicing of human short introns by screening siRNAs against 154 human nuclear proteins. The splicing activity was assayed
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service