AV39521
Anti-TEAD1 (AB1) antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(4)
Synonym(s):
Anti-TEA domain family member 1 (SV40 transcriptional enhancer factor)
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
46 kDa
species reactivity
horse, bovine, rabbit, human, rat, guinea pig, mouse, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TEAD1(7003)
General description
TEAD1 is a transcriptional factor that blocks the expression of prolactin in human uterine decidual cells. TEAD1 mutation has been linked to Sveinsson′s chorioretinal atrophy.
Rabbit Anti-TEAD1 antibody recognizes pig, zebrafish, human, mouse, rat, bovine, and canine TEAD1.
Rabbit Anti-TEAD1 antibody recognizes pig, zebrafish, human, mouse, rat, bovine, and canine TEAD1.
Immunogen
Synthetic peptide directed towards the C terminal region of human TEAD1
Application
Rabbit Anti-TEAD1 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for IHC at 16 μg/ml.
Biochem/physiol Actions
TEAD1 is a transcriptional enhancer. It interacts with a muscle-specific cofactor to promote skeletal muscle gene expression. The mutation in the TEAD1 gene is the cause of Sveinsson′s chorioretinal atrophy
Sequence
Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Ragnheidur Fossdal et al.
Human molecular genetics, 13(9), 975-981 (2004-03-16)
Sveinsson's chorioretinal atrophy (SCRA), also referred to as helicoid peripapillary chorioretinal degeneration or atrophia areata, is an autosomal dominant eye disease, characterized by symmetrical lesions radiating from the optic disc involving the retina and the choroid. Genome-wide linkage analysis mapped
Shohei Ikeda et al.
JACC. Basic to translational science, 4(5), 611-622 (2019-11-27)
Patients with diabetes are more prone to developing heart failure in the presence of high blood pressure than those without diabetes. Yes-associated protein (YAP), a key effector of the Hippo signaling pathway, is persistently activated in diabetic hearts, and YAP
Cherie A Kessler et al.
Molecular and cellular endocrinology, 295(1-2), 32-38 (2008-09-09)
Forced overexpression of TEAD1 in human uterine fibroblast (HUF) and human endometrial stromal cells markedly inhibited prolactin promoter activity in both cell types in a dose-dependent manner, with maximal inhibition of greater than 90%. Conversely, the knockdown of TEAD1 expression
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service