Skip to Content
Merck
CN
All Photos(3)

Documents

Safety Information

AV38933

Sigma-Aldrich

Anti-STAT1 (AB3) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp686B04100, Anti-ISGF-3, Anti-STAT91, Anti-Signal transducer and activator of transcription 1, 91 kDa

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

87 kDa

species reactivity

horse, human, guinea pig, rat, mouse, rabbit, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

NP_644671

UniProt accession no.

P42224

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STAT1(6772)

Immunogen

Synthetic peptide directed towards the N terminal region of human STAT1

Biochem/physiol Actions

Signal transducers and activators of transcription (STAT) are a group of proteins that mediate a wide range of cellular functions by activation of gene transcription. STAT1 is activated by IFG-γ, IFN-α, PDGF and IL-6. It acts with important signaling pathways mediated by JAK and MAPK to mediate inflammation and cell viability in response to pathogens and cell stimuli. STAT1 expression levels have prognostic value in in specific types of breast cancer.

Sequence

Synthetic peptide located within the following region: MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Shihao Chen et al.
Frontiers in microbiology, 11, 603131-603131 (2020-12-29)
Avian leukosis virus subgroup J (ALV-J), an oncogenic retrovirus, is known to cause immunosuppression and various types of cancer in chickens. Recent reports have shown that epigenetic changes in DNA and chromatin are widely implicated in the life cycle of
Antonis E Koromilas et al.
JAK-STAT, 2(2), e23353-e23353 (2013-09-24)
The anti-tumor function of STAT1 through its capacity to control the immune system and promote tumor immune surveillance has been well understood. However, little is known about cell autonomous (i.e., tumor cell-specific) functions of STAT1 in tumor formation. Recent studies
Nancy Au-Yeung et al.
JAK-STAT, 2(3), e23931-e23931 (2013-09-27)
STAT1 and STAT2 proteins are key mediators of type I and type III interferon (IFN) signaling, and are essential components of the cellular antiviral response and adaptive immunity. They associate with IFN regulatory factor 9 (IRF9) to form a heterotrimeric
Isabella Rauch et al.
JAK-STAT, 2(1), e23820-e23820 (2013-09-24)
Interferons (IFN) are subdivided into type I IFN (IFN-I, here synonymous with IFN-α/β), type II (IFN-γ) and type III IFN (IFN-III/IFN-λ) that reprogram nuclear gene expression through STATs 1 and 2 by forming STAT1 dimers (mainly IFN-γ) or the ISGF3
Yao-Tsung Yeh et al.
International journal of cancer, 118(12), 2943-2947 (2006-01-21)
Although it is known that STAT3 transcriptional activity is modulated by phosphorylation at serine residue 727, the role of STAT3 serine phosphorylation in breast cancer remains mostly unexplored. In this study, we examined the expression patterns of serine residue 727-phosphorylated
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service