AV38028
Anti-ELF4 (AB1) antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
Synonym(s):
Anti-E74-like factor 4 (ets domain transcription factor)
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
71 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ELF4(2000)
General description
ETS transcription factors share a conserved DNA-binding "ETS" domain and include several oncoproteins that induce tumorigenesis when overexpressed. The ETS family member E74-like factor 4 (ELF4) controls the ERK-mediated proliferation and homing of CD8+ T cells via Krüppel-like factors KLF4 and KLF2. ELF4 increase quiescence in bone marrow endothelial cells by the deregulation of cyclin-dependent kinase-4 expression and enhances regeneration of sinusoidal blood vessels.
Specificity
Anti-ELF4 (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, and canine E74-like factor 4 proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human ELF4
Application
Anti-ELF4 (AB1) polyclonal antibody is used to tag E74-like factor 4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E74-like factor 4 in the signaling and regulation of quiescence and proliferation of cells such at T-cells and endothelial cells.
Biochem/physiol Actions
ELF4 contains 1 ETS DNA-binding domain and belongs to the ETS family. It is transcriptional activator that binds to DNA sequences containing the consensus 5′-WGGA-3′. It transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. It acts synergistically with RUNX1 to transactivate the IL3 promoter and also transactivates the PRF1 promoter in natural killer (NK) cells. ELF4 plays a role in the development and function of NK and NK T-cells and in innate immunity.
Sequence
Synthetic peptide located within the following region: MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Lili Cao et al.
Science signaling, 12(573) (2019-03-21)
Precise control of interferons (IFNs) is crucial to maintain immune homeostasis. Here, we demonstrated that homeodomain-interacting protein kinase 2 (HIPK2) was required for the production of type I IFNs in response to RNA virus infection. HIPK2 deficiency markedly impaired IFN
Fuping You et al.
Nature immunology, 14(12), 1237-1246 (2013-11-05)
Induction of type I interferon is a central event of innate immunity, essential for host defense. Here we report that the transcription factor ELF4 is induced by type I interferon and upregulates interferon expression in a feed-forward loop. ELF4 deficiency
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service