AV37145
Anti-SREBF1 (AB1) antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
125 kDa
species reactivity
mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
mouse ... SREBF1(20787)
General description
Sterol regulatory element-binding protein 1 (SREBP1) is a member of the basic helix-loop-helix (bHLH) family of transcription factors.
Immunogen
Synthetic peptide directed towards the N terminal region of mouse SREBF1
Biochem/physiol Actions
Sterol regulatory element-binding protein 1 (SREBP1) regulates de novo lipogenesis. It can be used as a biomarker and a therapeutic target due to its function as an oncogene and a pro-proliferation factor in thyroid cancer. It bind to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.
Sterol regulatory element-binding transcription factor 1 (SREBF1) binds to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.
Sequence
Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Cuilin Li et al.
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 123, 109791-109791 (2019-12-31)
SREBP1 is a well-known transcript factor regulating lipogenesis. It has been reported to play an important role in tumor progress in recent years. However, the roles of SREBP1 in differentiated thyroid cancer (DTC) are uncertain. Based on this, we aimed
Delphine Eberlé et al.
Biochimie, 86(11), 839-848 (2004-12-14)
Sterol regulatory element binding proteins (SREBPs) are a family of transcription factors that regulate lipid homeostasis by controlling the expression of a range of enzymes required for endogenous cholesterol, fatty acid (FA), triacylglycerol and phospholipid synthesis. The three SREBP isoforms
Enrique M Toledo et al.
Cell reports, 31(5), 107601-107601 (2020-05-07)
Liver X receptors (LXRs) and their ligands are potent regulators of midbrain dopaminergic (mDA) neurogenesis and differentiation. However, the molecular mechanisms by which LXRs control these functions remain to be elucidated. Here, we perform a combined transcriptome and chromatin immunoprecipitation
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service