biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
36 kDa
species reactivity
canine, rabbit, bovine, mouse, human, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... PITX2(5308)
Looking for similar products? Visit Product Comparison Guide
General description
Paired-like homeodomain transcription factor 2 (PITX2) also known as pituitary homeobox 2 is a homeodomain transcription factor that regulates expression of genes critical for proper eye, tooth and abdominal organ development as well as expression of pituitary-specific genes including prolactin. Mutations in PITX2 cause Axenfeld-Rieger syndrome.
Immunogen
The immunogen for anti-PITX2 antibody: synthetic peptide derected towards the N terminal of human PITX2
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
J Drouin et al.
Molecular and cellular endocrinology, 140(1-2), 31-36 (1998-08-29)
A subfamily of bicoid-related homeodomain factors was recently discovered through its involvement in transcription of pituitary-specific genes. We isolated the first member of this family, Ptxl (pituitary homeobox 1), through its DNA binding properties whereas a second related gene, Ptx2
Jing Luo et al.
Cancer cell international, 19, 96-96 (2019-05-03)
The homeodomain transcription factor, PITX2 is associated with tumorigenesis of multiple cancers. In this research, we aimed to study the expression, function and mechanism of PITX2 in lung adenocarcinoma (LUAD). The TCGA dataset was used to analyze the expression and
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service