Skip to Content
Merck
CN
All Photos(2)

Key Documents

Safety Information

AV35127

Sigma-Aldrich

Anti-CUL5 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Cullin 5

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

86 kDa

species reactivity

mouse, human, horse, bovine, guinea pig, rat, rabbit, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CUL5(8065)

General description

Cul5- part of the Cullin family of proteins. It exhibits anti-proliferative characteristics due to its function in the Ring E3 ligase complex of the ubquitin system. It is expressed highly in cardiac and skeletal tissues.

Immunogen

Synthetic peptide directed towards the C terminal region of human CUL5

Biochem/physiol Actions

CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Sequence

Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Matthew D Petroski et al.
Nature reviews. Molecular cell biology, 6(1), 9-20 (2005-02-03)
Cullin-RING complexes comprise the largest known class of ubiquitin ligases. Owing to the great diversity of their substrate-receptor subunits, it is possible that there are hundreds of distinct cullin-RING ubiquitin ligases in eukaryotic cells, which establishes these enzymes as key
Qing Yu et al.
Neoplasia (New York, N.Y.), 22(4), 179-191 (2020-03-08)
Cullin-RING E3 ligase (CRL) is the largest family of E3 ubiquitin ligase, responsible for ubiquitylation of ∼20% of cellular proteins. CRL plays an important role in many biological processes, particularly in cancers due to abnormal activation. CRL activation requires neddylation
Tiantian Xu et al.
Signal transduction and targeted therapy, 7(1), 354-354 (2022-10-18)
Protein neddylation is catalyzed by a neddylation activating enzyme (NAE, E1), an E2 conjugating enzyme, and an E3 ligase. In various types of human cancers, the neddylation pathway is abnormally activated. Our previous study validated that the neddylation E2 UBE2F

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service