AV34537
Anti-KLHL25 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
Anti-Kelch-like 25 (Drosophila)
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
66 kDa
species reactivity
human, dog, mouse, rat, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... KLHL25(64410)
General description
KLHL25 is a kelch-like family member that complexes with CUL3 to form E3 ubiquitin ligase complex. This complex is known to target hypophosphorylated 4E-BP1.
Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.
Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.
Immunogen
Synthetic peptide directed towards the N terminal region of human KLHL25
Application
Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 μg/ml.
Biochem/physiol Actions
KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
Sequence
Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Molecular cell, 46(6), 847-858 (2012-05-15)
Translational control of gene expression plays a key role in many biological processes. Consequently, the activity of the translation apparatus is under tight homeostatic control. eIF4E, the mRNA 5' cap-binding protein, facilitates cap-dependent translation and is a major target for
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service