Skip to Content
Merck
CN
All Photos(2)

Key Documents

Safety Information

AV33888

Sigma-Aldrich

Anti-KLK6 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Bssp, Anti-Kallikrein-related peptidase 6, Anti-Klk7, Anti-MGC9355, Anti-NEUROSIN, Anti-PRSS18, Anti-PRSS9, Anti-SP59

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

25 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KLK6(5653)

General description

Kallikrein-6 (KLK6) also known as zyme is part of a family of serine proteases that targets xtracellular proteins including fibronectin, vitronectin and laminin. It is found highly expressed in the brain where it has been shown to be involved in degradation of amyloid plaque protein. Additionally, it has been implicated in carcinogensis and is being investigated for its potential as a target for cancer therapy.

Immunogen

Synthetic peptide directed towards the N terminal region of human KLK6

Biochem/physiol Actions

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer′s disease.Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. The encoded enzyme is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer′s disease. Multiple alternatively spliced transcript variants that encode different isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Angeliki Magklara et al.
Biochemical and biophysical research communications, 307(4), 948-955 (2003-07-25)
Human kallikrein 6 (hK6) is a trypsin-like serine protease, member of the human kallikrein gene family. Studies suggested a potential involvement of hK6 in the development and progression of Alzheimer's disease. The serum levels of hK6 might be used as
Jiayi Yao et al.
Circulation research, 117(9), 758-769 (2015-08-13)
Endothelial cells have the ability to undergo endothelial-mesenchymal transitions (EndMTs), by which they acquire a mesenchymal phenotype and stem cell-like characteristics. We previously found that EndMTs occurred in the endothelium deficient in matrix γ-carboxyglutamic acid protein enabling endothelial cells to

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service