AV32841
Anti-CHES1 antibody produced in rabbit
IgG fraction of antiserum
Sign Into View Organizational & Contract Pricing
All Photos(1)
Synonym(s):
Anti-Checkpoint suppressor 1
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
52 kDa
species reactivity
guinea pig, mouse, human, horse, rat, dog, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CHES1(1112)
General description
CHES1 (or FOXN3) is a forkhead transcription factor that modulates cell proliferation by supressing PIM2 and protein synthesis. FOXN3 has also been implicated in transcriptional repression, DNA damage responses, hematopoietic cancers, and oral cancers.
Rabbit Anti-CHES1 antibody recognizes chicken, zebrafish, human, mouse, rat, pig, and canine CHES1.
Rabbit Anti-CHES1 antibody recognizes chicken, zebrafish, human, mouse, rat, pig, and canine CHES1.
Immunogen
Synthetic peptide directed towards the C terminal region of human CHES1
Application
Rabbit Anti-CHES1 antibody can be used for western blot applications at a concentration of 1.25μg/ml
Biochem/physiol Actions
Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.
Sequence
Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Yin-Ju Chen et al.
Head & neck, 33(2), 257-266 (2010-09-18)
This study was undertaken to identify the genes in response to areca nut extract, a potential carcinogen of oral cancer. Two oral cancer sublines chronically treated with areca nut extract were established. Methods such as microarray and immunohistochemistry were used
Kenneth L Scott et al.
Gene, 359, 119-126 (2005-08-17)
Checkpoint Suppressor 1 (CHES1; FOXN3) encodes a member of the forkhead/winged-helix transcription factor family. The human CHES1 cDNA was originally identified by its ability to function as a high-copy suppressor of multiple checkpoint mutants of Saccharomyces cerevisiae. Accumulating expression profile
Valeria Busygina et al.
Cancer research, 66(17), 8397-8403 (2006-09-05)
Multiple endocrine neoplasia type 1 (MEN1) is a cancer susceptibility syndrome affecting several endocrine tissues. Investigations of the biochemical function of the MEN1 protein, menin, have suggested a role as a transcriptional comodulator. The mechanism by which MEN1 inactivation leads
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service