AV32553
Anti-LHX6 antibody produced in rabbit
IgG fraction of antiserum, lyophilized powder
Synonym(s):
Anti-LIM homeobox 6
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
40 kDa
species reactivity
human, bovine, rat, mouse, canine
technique(s)
immunohistochemistry: suitable, western blot: suitable
immunogen sequence
SRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSS
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... LHX6(26468)
General description
LHX6 is a LIM-domain containing transcription factor that is involved in delineating reproductive behaviours from amygdala to hypothalamus. This transcription factor is also needed for the specification and migration of cortical interneurons.
Rabbit Anti-LHX6 antibody recognizes mouse, canine, bovine, rat, and human LHX6.
Rabbit Anti-LHX6 antibody recognizes mouse, canine, bovine, rat, and human LHX6.
Immunogen
synthetic peptide corresponding to a region of human LHX6 with an internal ID of P03556.
Application
Rabbit Anti-LHX6 antibody can be used for western blot (1μg/ml) and IHC (4-8μg/ml) applications.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
13 - Non Combustible Solids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Gloria B Choi et al.
Neuron, 46(4), 647-660 (2005-06-10)
In mammals, innate reproductive and defensive behaviors are mediated by anatomically segregated connections between the amygdala and hypothalamus. This anatomic segregation poses the problem of how the brain integrates activity in these circuits when faced with conflicting stimuli eliciting such
Petros Liodis et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 27(12), 3078-3089 (2007-03-23)
The cerebral cortex contains two main neuronal cell populations, the excitatory glutamatergic (pyramidal) neurons and the inhibitory interneurons, which synthesize GABA and constitute 20-30% of all cortical neurons. In contrast to the mostly homogeneous population of projection neurons, cortical interneurons
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service