Skip to Content
Merck
CN

AV32553

Anti-LHX6 antibody produced in rabbit

IgG fraction of antiserum, lyophilized powder

Synonym(s):

Anti-LIM homeobox 6

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

40 kDa

species reactivity

human, bovine, rat, mouse, canine

technique(s)

immunohistochemistry: suitable, western blot: suitable

immunogen sequence

SRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSS

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... LHX6(26468)

General description

LHX6 is a LIM-domain containing transcription factor that is involved in delineating reproductive behaviours from amygdala to hypothalamus. This transcription factor is also needed for the specification and migration of cortical interneurons.
Rabbit Anti-LHX6 antibody recognizes mouse, canine, bovine, rat, and human LHX6.

Immunogen

synthetic peptide corresponding to a region of human LHX6 with an internal ID of P03556.

Application

Rabbit Anti-LHX6 antibody can be used for western blot (1μg/ml) and IHC (4-8μg/ml) applications.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

13 - Non Combustible Solids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Petros Liodis et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 27(12), 3078-3089 (2007-03-23)
The cerebral cortex contains two main neuronal cell populations, the excitatory glutamatergic (pyramidal) neurons and the inhibitory interneurons, which synthesize GABA and constitute 20-30% of all cortical neurons. In contrast to the mostly homogeneous population of projection neurons, cortical interneurons
Gloria B Choi et al.
Neuron, 46(4), 647-660 (2005-06-10)
In mammals, innate reproductive and defensive behaviors are mediated by anatomically segregated connections between the amygdala and hypothalamus. This anatomic segregation poses the problem of how the brain integrates activity in these circuits when faced with conflicting stimuli eliciting such

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service