AV32416
Anti-NEUROD6 (AB1) antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
Synonym(s):
Anti-Neurogenic differentiation 6
UNSPSC Code:
12352203
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
39 kDa
species reactivity
human, dog, mouse, bovine, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NEUROD6(63974)
General description
NEUROD6 is a basic helix-loop-helix (bHLH) transcription factor that belongs to the NeuroD subfamily of proteins. This transcription factor is regulated by promoters through CRE and C/EBP binding sites. Studies have reported that NeuroD6 defines novel retinal amacrine cells and modulates their fate.
Rabbit Anti-NEUROD6 (AB1) antibody recognizes canine, human, mouse, rat, bovine, and chicken NEUROD6.
Rabbit Anti-NEUROD6 (AB1) antibody recognizes canine, human, mouse, rat, bovine, and chicken NEUROD6.
Immunogen
Synthetic peptide directed towards the N terminal region of human NEUROD6
Application
Rabbit Anti-NEUROD6 (AB1) antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Biochem/physiol Actions
NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
Sequence
Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Martine Uittenbogaard et al.
Journal of neuroscience research, 85(1), 1-18 (2006-11-01)
Expression of the bHLH transcription factor Nex1/MATH-2/NeuroD6, a member of the NeuroD subfamily, parallels overt neuronal differentiation and synaptogenesis during brain development. Our previous studies have shown that Nex1 is a critical effector of the NGF pathway and promotes neuronal
Jeremy N Kay et al.
Nature neuroscience, 14(8), 965-972 (2011-07-12)
Most regions of the CNS contain many subtypes of inhibitory interneurons with specialized roles in circuit function. In the mammalian retina, the ∼30 subtypes of inhibitory interneurons called amacrine cells (ACs) are generally divided into two groups: wide/medium-field GABAergic ACs
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service