Skip to Content
Merck
CN
All Photos(1)

Key Documents

Safety Information

AV32416

Sigma-Aldrich

Anti-NEUROD6 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Neurogenic differentiation 6

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

human, dog, mouse, bovine, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NEUROD6(63974)

General description

NEUROD6 is a basic helix-loop-helix (bHLH) transcription factor that belongs to the NeuroD subfamily of proteins. This transcription factor is regulated by promoters through CRE and C/EBP binding sites. Studies have reported that NeuroD6 defines novel retinal amacrine cells and modulates their fate.
Rabbit Anti-NEUROD6 (AB1) antibody recognizes canine, human, mouse, rat, bovine, and chicken NEUROD6.

Immunogen

Synthetic peptide directed towards the N terminal region of human NEUROD6

Application

Rabbit Anti-NEUROD6 (AB1) antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Biochem/physiol Actions

NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.

Sequence

Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Martine Uittenbogaard et al.
Journal of neuroscience research, 85(1), 1-18 (2006-11-01)
Expression of the bHLH transcription factor Nex1/MATH-2/NeuroD6, a member of the NeuroD subfamily, parallels overt neuronal differentiation and synaptogenesis during brain development. Our previous studies have shown that Nex1 is a critical effector of the NGF pathway and promotes neuronal
Jeremy N Kay et al.
Nature neuroscience, 14(8), 965-972 (2011-07-12)
Most regions of the CNS contain many subtypes of inhibitory interneurons with specialized roles in circuit function. In the mammalian retina, the ∼30 subtypes of inhibitory interneurons called amacrine cells (ACs) are generally divided into two groups: wide/medium-field GABAergic ACs

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service