AV32263
Anti-ETV4 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
Synonym(s):
Anti-Ets variant gene 4 (E1A enhancer binding protein, E1AF)
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
54 kDa
species reactivity
mouse, rat, human, pig, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ETV4(2118)
General description
ETS variant gene 4 (ETV4, E1AF) is a transcription factor that regulates cell motility and invasiveness. It confers an invasive (metastatic) phenotype on various cancer cells via activation of genes such involved in cell mobilization such as HER2/neu and various matrix metalloproteinases. ETV4/E1AR activates the Rho/Rho-associated kinase pathway.
Rabbit polyclonal anti-ETV4 antibody reacts with bovine, mouse, human, and rat ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factors.
Immunogen
Synthetic peptide directed towards the middle region of human ETV4
Application
Rabbit Anti-ETV4 antibody has been used for immunofluorescence applications at 1:200 dilution using formaldehyde-fixed cells. The antibody can also be used for western blot applications at 0.5μg/ml.
Rabbit polyclonal anti-ETV4 antibody is used to tag ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor in cell mobilization and tumor metastasis/invasivness.
Biochem/physiol Actions
The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
Sequence
Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Annalisa Lorenzato et al.
Experimental cell research, 319(17), 2627-2636 (2013-08-21)
The human homolog of the yeast cse1 gene (CSE1L) is over-expressed in ovarian cancer. CSE1L forms complex with Ran and importin-α and has roles in nucleocytoplasmic traffic and gene expression. CSE1L accumulated in the nucleus of ovarian cancer cell lines
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service