AV31860
Anti-MyCBP antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
Anti-c-Myc binding protein
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
12 kDa
species reactivity
guinea pig, human, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MYCBP(26292)
General description
Rabbit polyclonal anti-MyCBP antibody reacts with human, mouse, rat, chicken, bovine, and canine c-Myc binding proteins.
c-Myc binding protein (MyCBP/AMY-1) binds the N-terminal region of myc and stimulates E box-dependent transcription of myc. MYCBP is up-regulated in colon carcinoma cells. MyCBP/AMY-1 is a trigger for erythrocyte differentiation. AMY-1 works as an inducer of human K562 cell differentiation upon induction of AraC.
Immunogen
Synthetic peptide directed towards the middle region of human MYCBP
Application
Rabbit Anti-EHF antibody can be used for western blot applications at a dilution of 1.25μg/ml. The product can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.
Rabbit polyclonal anti-MyCBP antibody is used to tag c-Myc binding protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of c-myc binding protein in the regulation of myc expression and erythrocyte differentiation.
Biochem/physiol Actions
The MYCBP gene encodes a protein that binds to the N-terminal region of MYC and stimulates the activation of E box-dependent transcription by MYC.
Sequence
Synthetic peptide located within the following region: AATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service