AV31648
Anti-LASS3 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
Anti-LAG1 homolog, ceramide synthase 3 (S. cerevisiae)
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
46 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LASS3(204219)
General description
Longevity assurance homologue 3 (LASS3) is a testis-specific (dihyrdo)ceramide synthase that acts on a broad range of substrates. LASS3 is known to have two transcriptional variants, comprising of a 384-amino acid protein and a 419-amino acid protein.
Rabbit Anti-LASS3 antibody recognizes zebrafish, chicken, human, mouse, rat, bovine, and canine LASS3.
Rabbit Anti-LASS3 antibody recognizes zebrafish, chicken, human, mouse, rat, bovine, and canine LASS3.
Immunogen
Synthetic peptide directed towards the N terminal region of human LASS3
Application
Rabbit Anti-LASS3 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Biochem/physiol Actions
The gene encoding the hypothetical protein LASS3 is located on chromosome 15.
Sequence
Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The Biochemical journal, 398(3), 531-538 (2006-06-07)
The LASS (longevity assurance homologue) family members are highly conserved from yeasts to mammals. Five mouse and human LASS family members, namely LASS1, LASS2, LASS4, LASS5 and LASS6, have been identified and characterized. In the present study we cloned two
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service