AV13107
Anti-RAB14 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(4)
Synonym(s):
Anti-RAB14, member RAS oncogene family
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
24 kDa
species reactivity
rat, goat, human, pig, bovine, mouse, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RAB14(51552)
Immunogen
Synthetic peptide directed towards the C terminal region of human RAB14
Application
Anti-RAB14 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
RAB14 is a member of Rab GTPases that regulate the roles and identity of endosomes. Rab14 collaborates with FAM116 in regulating proteolytic cleavage of N-cadherin, and modulation of cell-cell adhesion and cell motility. Rab14 mediates the endocytic transport of GLUT4 from cytoplasmic compartments to cell surface.
Sequence
Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Sam E Reed et al.
Journal of cell science, 126(Pt 9), 1931-1941 (2013-02-28)
Insulin enhances the uptake of glucose into adipocytes and muscle cells by promoting the redistribution of the glucose transporter isoform 4 (GLUT4) from intracellular compartments to the cell surface. Rab GTPases regulate the trafficking itinerary of GLUT4 and several have
Rytis Prekeris
Developmental cell, 22(5), 909-910 (2012-05-19)
Linford et al. define a Rab14-mediated endocytic recycling pathway that controls proteolytic N-cadherin cleavage by transporting ADAM10 protease to the plasma membrane. When this pathway is disrupted, diminished ADAM10-dependent N-cadherin shedding leads to increased cell-cell adhesion and inhibition of cell
Andrea Linford et al.
Developmental cell, 22(5), 952-966 (2012-05-19)
Rab GTPases define the vesicle trafficking pathways underpinning cell polarization and migration. Here, we find that Rab4, Rab11, and Rab14 and the candidate Rab GDP-GTP exchange factors (GEFs) FAM116A and AVL9 are required for cell migration. Rab14 and its GEF
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service