Skip to Content
Merck
CN

AV13026

Anti-GABRA2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-γ-Aminobutyric acid (GABA) A receptor, α 2

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

bovine, rat, rabbit, human, horse, dog, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GABRA2(2555)

General description

GABA-A is a receptor for the major inhibitory neurotransmitter in mammalian brain, gamma-aminobutyric acid (GABA). Gamma-Aminobutyric acid (GABA) A receptor, α-2 (GABRA2) is one of sixteen subunits of GABA-A receptors currenly identified. Variants in GABRA2 have been cautiously associated with alcoholism.
Rabbit polyclonal anti-GABRA2 antibody reacts with canine, bovine, human, mouse, and rat Gamma-Aminobutyric acid (GABA) A receptor, α-2 subunits.

Immunogen

Synthetic peptide directed towards the middle region of human GABRA2

Application

Rabbit polyclonal anti-GABRA2 antibody is used to tag Gamma-Aminobutyric acid (GABA) A receptor, α-2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Gamma-Aminobutyric acid (GABA) A receptor, α-2 in alcohol dependency/alcoholism. Anti-GABRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Courtney Clyburn et al.
American journal of physiology. Gastrointestinal and liver physiology, 317(1), G40-G50 (2019-05-03)
Perinatal high-fat diet (pHFD) exposure increases the inhibition of dorsal motor nucleus of the vagus (DMV) neurons, potentially contributing to the dysregulation of gastric functions. The aim of this study was to test the hypothesis that pHFD increases the inhibition

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service