AV100859
Anti-PAX2 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Paired box gene 2
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
45 kDa
species reactivity
canine, human, rat, mouse, zebrafish, guinea pig, sheep, bovine, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... PAX2(5076)
General description
Paired box (PAX) genes are tissue specific homeodomain transcription factors involved in fetal and early animal tissue and cell specification and processes such as limb regeneration. Paired box gene 2 (PAX2) is involved in kidney nephron differentiation and branching morphogenesis of the metanephros. PAX2 and PAX8 are essential for the initiation of pro- and mesonephros development. PAX2 is involved in the regulation of ERBB2/HER2 transcription in breast cancer cells.
Specificity
Rabbit polyclonal anti-PAX2 antibody reacts with human, mouse, rat, zebrafish, and chicken paired box gene 2 transcription factors.
Immunogen
The immunogen for anti-PAX2 antibody: synthetic peptide derected towards the middle region of human PAX2
Application
Rabbit polyclonal anti-PAX2 antibody is used to tag paired box gene 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of paired box gene 2 in pro- and mesonephros development and HER2 expression in breast cancers. PAX2 is a marker in differentiating diffuse malignant mesotheliomas of peritoneum (DPMM) from serous carcinomas of müllerian origin. Anti-PAX2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Sequence
Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Sami Kamel Boualia et al.
Developmental biology, 382(2), 555-566 (2013-08-08)
Translating the developmental program encoded in the genome into cellular and morphogenetic functions requires the deployment of elaborate gene regulatory networks (GRNs). GRNs are especially crucial at the onset of organ development where a few regulatory signals establish the different
David Beauchemin et al.
Molecular cancer, 10, 148-148 (2011-12-16)
Metastasis is the leading cause of death among breast cancer patients. Identifying key cellular factors controlling invasion and metastasis of breast cancer cells should pave the way to new therapeutic strategies efficiently interfering with the metastatic process. PAX2 (paired box
R Wehr et al.
The International journal of developmental biology, 40(1), 369-377 (1996-02-01)
Pax genes encode transcription factors sharing a highly conserved sequence, the paired box. Their temporally and spatially restricted expression patterns during development indicate that Pax genes are involved in important steps of nervous system formation. Mutations in Pax genes have
Zhigang Cai et al.
Developmental dynamics : an official publication of the American Association of Anatomists, 243(10), 1310-1316 (2014-04-23)
Heparan sulfate proteoglycans (HSPG) are important for embryonic development by means of the regulation of gradient formation and signaling of multiple growth factors and morphogens. Previous studies have shown that Bmp/Shh/Fgf signaling are required for the regionalization of the optic
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service