AV100775
Anti-TCF4 (AB1) antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(2)
Anti-Transcription factor 4
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
71 kDa
species reactivity
mouse, horse, guinea pig, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... TCF4(6925)
General description
TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.
Immunogen
Synthetic peptide directed towards the N terminal region of human TCF4
Application
Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
TCF-4 mediates the transformation of epithelial cells of colon in the absence of APC gene expression. The expression of TCF-4 is required to establish the proliferative progenitors to form the crypts of embryonic small intestine. TCF-4 collaborates with b-catenin to regulate the colorectal transformation process. Lack of TCF-4 expression results in developmental delay and intellectual disability termed as Pitt-Hopkins syndrome.
Sequence
Synthetic peptide located within the following region: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Experimental & molecular medicine, 45, e21-e21 (2013-05-04)
TCF4 (transcription factor 4; E2-2, ITF2) is a transcription factor that when haplo-insufficient causes Pitt-Hopkins Syndrome (PTHS), an autism-spectrum disorder that is associated with pervasive developmental delay and severe intellectual disability. The TCF4 gene is also a risk factor with
Cell, 111(2), 241-250 (2002-11-01)
The transactivation of TCF target genes induced by Wnt pathway mutations constitutes the primary transforming event in colorectal cancer (CRC). We show that disruption of beta-catenin/TCF-4 activity in CRC cells induces a rapid G1 arrest and blocks a genetic program
Nature genetics, 19(4), 379-383 (1998-08-11)
Mutations of the genes encoding APC or beta-catenin in colon carcinoma induce the constitutive formation of nuclear beta-catenin/Tcf-4 complexes, resulting in activated transcription of Tcf target genes. To study the physiological role of Tcf-4 (which is encoded by the Tcf7/2
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service