Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.43
UNSPSC Code:
12352203
Product Name
Anti-CDK6 antibody produced in rabbit, IgG fraction of antiserum
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
37 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... CDK6(1021)
Application
Anti-CDK6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.625 μg/ml.
Biochem/physiol Actions
CDK6 is a D-type cyclin dependent kinase that initiates the phosphorylation of Rb tumor suppressor protein. In selected cell types the cyclin D/CDK6 activity is essential for cell proliferation. In collaboration with pRb, CDK6 has been discovered to play an important role in cell differentiation and in maintaining the cell cycle exit during differentiation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
CDK6 is a cyclin-dependent kinase important in regulating cell cycle progression specifically transitioning from G1 to G1/S phase.
Immunogen
Synthetic peptide directed towards the C terminal region of human CDK6
Other Notes
Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Naoko Ohtani et al.
The journal of medical investigation : JMI, 51(3-4), 146-153 (2004-10-06)
The p16INK4a tumor suppressor protein functions as an inhibitor of CDK4 and CDK6, the D-type cyclin-dependent kinases that initiate the phosphorylation of the retinoblastoma tumor suppressor protein, RB. Thus, p16INK4a has the capacity to arrest cells in the G1-phase of
Martha J Grossel et al.
Cell cycle (Georgetown, Tex.), 5(3), 266-270 (2006-01-18)
Over ten years ago, cdk6 was identified as a new member in a family of vertebrate cdc-2 related kinases. This novel kinase was found to partner with the D-type cyclins and to possess pRb kinase activity in vitro. Recently, several
Katarzyna Kozar et al.
Cell cycle (Georgetown, Tex.), 4(3), 388-391 (2005-03-02)
D-type cyclins (cyclin D1, D2 and D3) and their associated cyclin-dependent kinases CDK4 and CDK6 were thought to represent important, perhaps essential components of the core cell cycle apparatus. However, recent analyses of mice lacking D-cyclins, or CDK4 and CDK6
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service