AV02008
Anti-BCL2L1 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
Anti-BCL2-like 1
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
26 kDa
species reactivity
canine, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... BCL2L1(598)
General description
BCL2L1 is a signaling molecule that is known to regulate neuronal apoptosis. Furthermore, BCL2L1 can facilitate the survival of retinal ganglion cells.
Rabbit Anti-BCL2L1 associates with bovine, human, rabbit, canine, and pig BCL2L1.
Rabbit Anti-BCL2L1 associates with bovine, human, rabbit, canine, and pig BCL2L1.
Immunogen
Synthetic peptide directed towards the N terminal region of human BCL2L1
Application
Rabbit Anti-BCL2L1 can be used for western blot applications at a concentration of 1μg/ml.
Sequence
Synthetic peptide located within the following region: LVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSW
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Molecular and cellular neurosciences, 51(1-2), 53-59 (2012-07-28)
The Bcl-2 family is responsible for regulating cell death pathways in neurons during development, after injury and in disease. The activation of the pro-death family member BAX is often the final step before cell death in neurons. Pro-survival family members
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service