APREST89807
PrEST Antigen EEF2
Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution
Synonym(s):
EEF-2, EF2
Select a Size
CN¥1,869.36
Available to ship onApril 16, 2025Details
Select a Size
About This Item
CN¥1,869.36
Available to ship onApril 16, 2025Details
Recommended Products
recombinant
expressed in E. coli
Assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 29 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
SKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPV
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
1 of 4
This Item | 57030U | 57265 | 57044 |
---|---|---|---|
application(s) environmental | application(s) environmental | application(s) food and beverages | application(s) environmental |
material UHMW PE frit, polypropylene tube | material UHMW PE frit, polypropylene tube | material PTFE frit, polypropylene tube | material polypropylene tube |
agency suitable for DIN 38407-42 | agency suitable for DIN 38407-42, suitable for EPA 1633, suitable for EPA 533, suitable for EPA 537.1, suitable for EPA ACB B21-02, suitable for EPA ACB B23-05b, suitable for EPA OTM-45, suitable for GB 31604.35-2016, suitable for ISO 21675 2019, suitable for ISO 25101, suitable for ISO/CEN 15968-2010 | agency - | agency - |
reg. compliance suitable for FDA C-010.02 | reg. compliance suitable for FDA C-010.02 | reg. compliance - | reg. compliance - |
product line Visiprep™ | product line Visiprep™ | product line Visiprep™ | product line - |
General description
Application
Linkage
Physical form
Preparation Note
Legal Information
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
Choose from one of the most recent versions:
Certificates of Analysis (COA)
It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.
If you need assistance, please contact Customer Support.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service