Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.75
UNSPSC Code:
12352200
Form:
liquid
Assay:
≥90% (SDS-PAGE)
Biological source:
human
Recombinant:
expressed in E. coli
biological source
human
recombinant
expressed in E. coli
description
0.05 mg of recombinant human CD164 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
sterility
Filtered sterilized solution
assay
≥90% (SDS-PAGE)
form
liquid
packaging
pkg of 50 μg
concentration
0.5 mg protein/mL
accession no.
NP_006007
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... CD164(8763)
Application
Coating a plate well (6 well plate) with this recombinant CD164 matrix protein in HSC cell specific medium at 1-10 μg/well allows for human HSC / receptor interaction studies in vitro.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained
Preparation Note
The full-length extracellular domain of the human CD164 cDNA (24 - 162 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.
Other Notes
MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Storage Class
10 - Combustible liquids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
P T Ramos et al.
Materials science & engineering. C, Materials for biological applications, 103, 109742-109742 (2019-07-28)
This study aimed to develop nanocapsules containing ketoprofen using rose hip oil (Keto-NC) as oil core, and to evaluate their anti-inflammatory activity in acute and chronic ear edema models in mice. Physicochemical characterization, drug release, photostability and cytotoxicity assays were
Felipe Díaz-Soler et al.
Nanomaterials (Basel, Switzerland), 11(1) (2021-01-23)
In this work, calcium oxalate (CaOx) precursors were stabilized by poly(acrylic acid) (PAA) as an additive under in vitro crystallization assays involving the formation of pre-nucleation clusters of CaOx via a non-classical crystallization (NCC) pathway. The in vitro crystallization of
Krishni Fernando et al.
Microorganisms, 8(6) (2020-07-01)
Asexual Epichloë spp. fungal endophytes have been extensively studied for their functional secondary metabolite production. Historically, research mostly focused on understanding toxicity of endophyte-derived compounds on grazing livestock. However, endophyte-derived compounds also provide protection against invertebrate pests, disease, and other
Meera Thomas et al.
The Journal of chemical physics, 150(9), 094903-094903 (2019-03-10)
We report salt-induced swelling transitions of a lamellar complex of the anionic polyelectrolyte, poly(acrylic acid sodium salt) (PAANa), and the cationic amphiphile, didodecyldimethylammonium chloride (DDAC). Increasing the concentration of NaCl in the solution is found to lead to a collapsed
Benedikt Demmert et al.
Materials (Basel, Switzerland), 12(11) (2019-06-07)
Calcareous biominerals typically feature a hybrid nanogranular structure consisting of calcium carbonate nanograins coated with organic matrices. This nanogranular organisation has a beneficial effect on the functionality of these bioceramics. In this feasibility study, we successfully employed a flow-chemistry approach
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service